Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0

  1. Avatar for cinnamonkitty 131. cinnamonkitty Lv 1 2 pts. 8,256
  2. Avatar for martinf 132. martinf Lv 1 2 pts. 8,236
  3. Avatar for parsnip 133. parsnip Lv 1 2 pts. 8,198
  4. Avatar for Ref_Jo 134. Ref_Jo Lv 1 2 pts. 8,198
  5. Avatar for severin333 135. severin333 Lv 1 2 pts. 8,187
  6. Avatar for Komeiji_Koishi 136. Komeiji_Koishi Lv 1 2 pts. 8,177
  7. Avatar for HMK 137. HMK Lv 1 2 pts. 8,166
  8. Avatar for kosyumote 138. kosyumote Lv 1 2 pts. 8,161
  9. Avatar for NotJim99 139. NotJim99 Lv 1 2 pts. 8,157
  10. Avatar for D001x_ErlandStevens 140. D001x_ErlandStevens Lv 1 2 pts. 8,144

Comments