Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  1. Avatar for xplocast1 141. xplocast1 Lv 1 1 pt. 8,105
  2. Avatar for AlanmanAaron 142. AlanmanAaron Lv 1 1 pt. 8,094
  3. Avatar for PatPetersen127 143. PatPetersen127 Lv 1 1 pt. 8,093
  4. Avatar for GreekCivilization 144. GreekCivilization Lv 1 1 pt. 8,089
  5. Avatar for almax22 145. almax22 Lv 1 1 pt. 8,057
  6. Avatar for nagistick 146. nagistick Lv 1 1 pt. 8,049
  7. Avatar for Graham MF 147. Graham MF Lv 1 1 pt. 8,034
  8. Avatar for Iron pet 148. Iron pet Lv 1 1 pt. 8,026
  9. Avatar for AeonFluff 149. AeonFluff Lv 1 1 pt. 8,013
  10. Avatar for Arne Heessels 150. Arne Heessels Lv 1 1 pt. 8,010

Comments