Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0

  1. Avatar for FreeT 151. FreeT Lv 1 1 pt. 8,007
  2. Avatar for sheerbliss 152. sheerbliss Lv 1 1 pt. 7,984
  3. Avatar for nathanmills 153. nathanmills Lv 1 1 pt. 7,976
  4. Avatar for FreeFolder 154. FreeFolder Lv 1 1 pt. 7,948
  5. Avatar for karost 155. karost Lv 1 1 pt. 7,931
  6. Avatar for Tac1 156. Tac1 Lv 1 1 pt. 7,890
  7. Avatar for momadoc 157. momadoc Lv 1 1 pt. 7,852
  8. Avatar for Technophysicist 158. Technophysicist Lv 1 1 pt. 7,844
  9. Avatar for Hollinas 159. Hollinas Lv 1 1 pt. 7,814
  10. Avatar for housey8 160. housey8 Lv 1 1 pt. 7,778

Comments