Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0

  1. Avatar for Deleted player 171. Deleted player 1 pt. 7,671
  2. Avatar for Threeoak 172. Threeoak Lv 1 1 pt. 7,583
  3. Avatar for bwkittitas 173. bwkittitas Lv 1 1 pt. 7,534
  4. Avatar for Chinotauku 174. Chinotauku Lv 1 1 pt. 7,514
  5. Avatar for pandapharmd 175. pandapharmd Lv 1 1 pt. 7,512
  6. Avatar for Alipony 176. Alipony Lv 1 1 pt. 7,496
  7. Avatar for lockert 177. lockert Lv 1 1 pt. 7,467
  8. Avatar for mirjamvandelft 178. mirjamvandelft Lv 1 1 pt. 7,385
  9. Avatar for Fetztastic 179. Fetztastic Lv 1 1 pt. 7,371
  10. Avatar for kyuheonre1024 180. kyuheonre1024 Lv 1 1 pt. 7,344

Comments