Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0

  1. Avatar for 01010011111 181. 01010011111 Lv 1 1 pt. 7,315
  2. Avatar for ELF57Hz 182. ELF57Hz Lv 1 1 pt. 7,238
  3. Avatar for fmr19d 183. fmr19d Lv 1 1 pt. 7,192
  4. Avatar for Pro Lapser 184. Pro Lapser Lv 1 1 pt. 7,172
  5. Avatar for Festering Wounds 185. Festering Wounds Lv 1 1 pt. 7,165
  6. Avatar for Mydogisa Toelicker 187. Mydogisa Toelicker Lv 1 1 pt. 7,148
  7. Avatar for Soggy Doglog 188. Soggy Doglog Lv 1 1 pt. 7,145
  8. Avatar for Mr_Jolty 189. Mr_Jolty Lv 1 1 pt. 7,144
  9. Avatar for Truncheon Luncheon 190. Truncheon Luncheon Lv 1 1 pt. 7,139

Comments