Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0

  1. Avatar for Mark- 11. Mark- Lv 1 81 pts. 9,172
  2. Avatar for christioanchauvin 12. christioanchauvin Lv 1 79 pts. 9,172
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 77 pts. 9,170
  4. Avatar for mirp 14. mirp Lv 1 75 pts. 9,149
  5. Avatar for Galaxie 15. Galaxie Lv 1 74 pts. 9,147
  6. Avatar for nemo7731 16. nemo7731 Lv 1 72 pts. 9,125
  7. Avatar for g_b 17. g_b Lv 1 70 pts. 9,110
  8. Avatar for grogar7 18. grogar7 Lv 1 69 pts. 9,110
  9. Avatar for reefyrob 19. reefyrob Lv 1 67 pts. 9,108
  10. Avatar for Susume 20. Susume Lv 1 66 pts. 9,085

Comments