Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  1. Avatar for TJOK fan 191. TJOK fan Lv 1 1 pt. 7,139
  2. Avatar for isantheautumn 192. isantheautumn Lv 1 1 pt. 7,138
  3. Avatar for Mohambone 193. Mohambone Lv 1 1 pt. 7,134
  4. Avatar for NameChangeNeeded01 194. NameChangeNeeded01 Lv 1 1 pt. 7,128
  5. Avatar for mondetta77 195. mondetta77 Lv 1 1 pt. 7,107
  6. Avatar for larry25427 196. larry25427 Lv 1 1 pt. 7,076
  7. Avatar for DScott 197. DScott Lv 1 1 pt. 7,054
  8. Avatar for tscarberry1 198. tscarberry1 Lv 1 1 pt. 6,656
  9. Avatar for doctaven 199. doctaven Lv 1 1 pt. 6,653
  10. Avatar for MaartenDesnouck 200. MaartenDesnouck Lv 1 1 pt. 6,618

Comments