Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  1. Avatar for forscience2.0 201. forscience2.0 Lv 1 1 pt. 6,460
  2. Avatar for Wheeler22 202. Wheeler22 Lv 1 1 pt. 6,379
  3. Avatar for Everelle 203. Everelle Lv 1 1 pt. 6,325
  4. Avatar for GU13129 204. GU13129 Lv 1 1 pt. 6,242
  5. Avatar for Helge1 205. Helge1 Lv 1 1 pt. 6,159
  6. Avatar for sylvieh 206. sylvieh Lv 1 1 pt. 6,107
  7. Avatar for pandabearsecond 207. pandabearsecond Lv 1 1 pt. 6,050
  8. Avatar for briemoney 208. briemoney Lv 1 1 pt. 6,025
  9. Avatar for inkycatz 209. inkycatz Lv 1 1 pt. 6,008
  10. Avatar for penteplayer 210. penteplayer Lv 1 1 pt. 5,992

Comments