Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  1. Avatar for kitek314_pl 31. kitek314_pl Lv 1 50 pts. 9,020
  2. Avatar for frood66 32. frood66 Lv 1 49 pts. 9,019
  3. Avatar for gdnskye 33. gdnskye Lv 1 48 pts. 9,016
  4. Avatar for mimi 34. mimi Lv 1 47 pts. 9,015
  5. Avatar for pauldunn 35. pauldunn Lv 1 46 pts. 9,009
  6. Avatar for justjustin 36. justjustin Lv 1 44 pts. 8,994
  7. Avatar for pmthomson90 37. pmthomson90 Lv 1 43 pts. 8,987
  8. Avatar for dcrwheeler 38. dcrwheeler Lv 1 42 pts. 8,980
  9. Avatar for phi16 39. phi16 Lv 1 41 pts. 8,977
  10. Avatar for joremen 40. joremen Lv 1 40 pts. 8,970

Comments