Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for GUGITBIOTECH 21. GUGITBIOTECH 1 pt. 6,242
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0

  1. Avatar for MurloW 51. MurloW Lv 1 30 pts. 8,904
  2. Avatar for steveB 52. steveB Lv 1 29 pts. 8,893
  3. Avatar for jamiexq 53. jamiexq Lv 1 28 pts. 8,890
  4. Avatar for mammuthus 54. mammuthus Lv 1 28 pts. 8,889
  5. Avatar for hansvandenhof 55. hansvandenhof Lv 1 27 pts. 8,876
  6. Avatar for diamonddays 56. diamonddays Lv 1 26 pts. 8,866
  7. Avatar for darioarena 57. darioarena Lv 1 25 pts. 8,865
  8. Avatar for Bletchley Park 58. Bletchley Park Lv 1 25 pts. 8,861
  9. Avatar for pmdpmd 59. pmdpmd Lv 1 24 pts. 8,860
  10. Avatar for drumpeter18yrs9yrs 60. drumpeter18yrs9yrs Lv 1 23 pts. 8,853

Comments