Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,245
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,244
  3. Avatar for Gargleblasters 3. Gargleblasters 61 pts. 9,219
  4. Avatar for Contenders 4. Contenders 47 pts. 9,218
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 35 pts. 9,173
  6. Avatar for Go Science 6. Go Science 26 pts. 9,170
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 19 pts. 9,154
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,084
  9. Avatar for BOINC@Poland 9. BOINC@Poland 10 pts. 9,020
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 8,987
  1. Avatar for ManVsYard 11. ManVsYard Lv 1 21 pts. 9,216
  2. Avatar for smholst 12. smholst Lv 1 18 pts. 9,214
  3. Avatar for Blipperman 13. Blipperman Lv 1 15 pts. 9,214
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 12 pts. 9,214
  5. Avatar for andrewxc 15. andrewxc Lv 1 10 pts. 9,212
  6. Avatar for Norrjane 16. Norrjane Lv 1 8 pts. 9,211
  7. Avatar for dbuske 17. dbuske Lv 1 6 pts. 9,209
  8. Avatar for LagMasterSam 18. LagMasterSam Lv 1 5 pts. 9,203
  9. Avatar for Bruno Kestemont 19. Bruno Kestemont Lv 1 4 pts. 9,170
  10. Avatar for DodoBird 20. DodoBird Lv 1 3 pts. 9,170

Comments