Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups


  1. Avatar for Void Crushers 100 pts. 9,245
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,244
  3. Avatar for Gargleblasters 3. Gargleblasters 61 pts. 9,219
  4. Avatar for Contenders 4. Contenders 47 pts. 9,218
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 35 pts. 9,173
  6. Avatar for Go Science 6. Go Science 26 pts. 9,170
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 19 pts. 9,154
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,084
  9. Avatar for BOINC@Poland 9. BOINC@Poland 10 pts. 9,020
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 8,987

  1. Avatar for pauldunn 31. pauldunn Lv 1 1 pt. 9,135
  2. Avatar for ViJay7019 32. ViJay7019 Lv 1 1 pt. 9,124
  3. Avatar for phi16 33. phi16 Lv 1 1 pt. 9,123
  4. Avatar for alwen 34. alwen Lv 1 1 pt. 9,120
  5. Avatar for justjustin 35. justjustin Lv 1 1 pt. 9,112
  6. Avatar for jamiexq 36. jamiexq Lv 1 1 pt. 9,111
  7. Avatar for alcor29 37. alcor29 Lv 1 1 pt. 9,104
  8. Avatar for O Seki To 38. O Seki To Lv 1 1 pt. 9,078

Comments