Placeholder image of a protein
Icon representing a puzzle

1215b: Unsolved De-novo Freestyle 76

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 03, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Note: This puzzle replaces the original Puzzle 1215 which was mistakenly posted with the incorrect sequence.



Sequence:


DTNEVEKLEKMVREIARYGTVEVERRGDTIRVQDETGGQRIEILPSREVIRKVKELFKKIKELVRE

Top groups

  1. Avatar for Void Crushers
    1. Void Crushers
    100 pts. 9,245
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 9,244
  3. Avatar for Gargleblasters 3. Gargleblasters 61 pts. 9,219
  4. Avatar for Contenders 4. Contenders 47 pts. 9,218
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 35 pts. 9,173
  6. Avatar for Go Science 6. Go Science 26 pts. 9,170
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 19 pts. 9,154
  8. Avatar for HMT heritage 8. HMT heritage 14 pts. 9,084
  9. Avatar for BOINC@Poland 9. BOINC@Poland 10 pts. 9,020
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 8,987
  1. Avatar for cavern 221. cavern Lv 1 1 pt. 2,485
  2. Avatar for JordanReed44 222. JordanReed44 Lv 1 1 pt. 0
  3. Avatar for packer 223. packer Lv 1 1 pt. 0
  4. Avatar for MAEVLA 224. MAEVLA Lv 1 1 pt. 0
  5. Avatar for jbmkfm125 225. jbmkfm125 Lv 1 1 pt. 0
  6. Avatar for zkm 226. zkm Lv 1 1 pt. 0
  7. Avatar for DodoBird 227. DodoBird Lv 1 1 pt. 0
  8. Avatar for 0v1 228. 0v1 Lv 1 1 pt. 0
  9. Avatar for Paulo Roque 229. Paulo Roque Lv 1 1 pt. 0
  10. Avatar for Michael.Chevalier 230. Michael.Chevalier Lv 1 1 pt. 0

Comments