Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 4 pts. 9,617
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 3 pts. 9,597
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 2 pts. 9,570
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 9,539
  5. Avatar for Natural Abilities 15. Natural Abilities 1 pt. 9,493
  6. Avatar for Richard Dawkins Foundation 16. Richard Dawkins Foundation 1 pt. 9,199
  7. Avatar for Mojo Risin' 17. Mojo Risin' 1 pt. 9,185
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,136
  9. Avatar for Deleted group 19. Deleted group pts. 9,120
  10. Avatar for freefolder 20. freefolder 1 pt. 9,100
  1. Avatar for t012 61. t012 Lv 1 21 pts. 9,650
  2. Avatar for fiendish_ghoul 62. fiendish_ghoul Lv 1 21 pts. 9,642
  3. Avatar for WarpSpeed 63. WarpSpeed Lv 1 20 pts. 9,641
  4. Avatar for Norrjane 64. Norrjane Lv 1 20 pts. 9,637
  5. Avatar for Anfinsen_slept_here 65. Anfinsen_slept_here Lv 1 19 pts. 9,633
  6. Avatar for andrewxc 66. andrewxc Lv 1 18 pts. 9,631
  7. Avatar for Giant Berk 67. Giant Berk Lv 1 18 pts. 9,630
  8. Avatar for Glen B 68. Glen B Lv 1 17 pts. 9,624
  9. Avatar for gurch 69. gurch Lv 1 17 pts. 9,624
  10. Avatar for stomjoh 70. stomjoh Lv 1 16 pts. 9,622

Comments