Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,815
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 9,810
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 9,808
  4. Avatar for Go Science 4. Go Science 47 pts. 9,804
  5. Avatar for Contenders 5. Contenders 35 pts. 9,773
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,772
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,747
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,724
  9. Avatar for Deleted group 9. Deleted group pts. 9,715
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,665
  1. Avatar for t012 61. t012 Lv 1 21 pts. 9,650
  2. Avatar for fiendish_ghoul 62. fiendish_ghoul Lv 1 21 pts. 9,642
  3. Avatar for WarpSpeed 63. WarpSpeed Lv 1 20 pts. 9,641
  4. Avatar for Norrjane 64. Norrjane Lv 1 20 pts. 9,637
  5. Avatar for Anfinsen_slept_here 65. Anfinsen_slept_here Lv 1 19 pts. 9,633
  6. Avatar for andrewxc 66. andrewxc Lv 1 18 pts. 9,631
  7. Avatar for Giant Berk 67. Giant Berk Lv 1 18 pts. 9,630
  8. Avatar for Glen B 68. Glen B Lv 1 17 pts. 9,624
  9. Avatar for gurch 69. gurch Lv 1 17 pts. 9,624
  10. Avatar for stomjoh 70. stomjoh Lv 1 16 pts. 9,622

Comments