Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286
  1. Avatar for hada 111. hada Lv 1 4 pts. 9,484
  2. Avatar for pandapharmd 112. pandapharmd Lv 1 4 pts. 9,483
  3. Avatar for harvardman 113. harvardman Lv 1 4 pts. 9,483
  4. Avatar for Mydogisa Toelicker 114. Mydogisa Toelicker Lv 1 3 pts. 9,482
  5. Avatar for JMStiffler 115. JMStiffler Lv 1 3 pts. 9,481
  6. Avatar for SouperGenious 116. SouperGenious Lv 1 3 pts. 9,480
  7. Avatar for Mohambone 117. Mohambone Lv 1 3 pts. 9,480
  8. Avatar for manu8170 118. manu8170 Lv 1 3 pts. 9,479
  9. Avatar for NameChangeNeeded01 119. NameChangeNeeded01 Lv 1 3 pts. 9,476
  10. Avatar for uihcv 120. uihcv Lv 1 3 pts. 9,459

Comments