Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286
  1. Avatar for leehaggis 131. leehaggis Lv 1 2 pts. 9,411
  2. Avatar for Colostomy EXPLOSION. 132. Colostomy EXPLOSION. Lv 1 2 pts. 9,409
  3. Avatar for Truncheon Luncheon 133. Truncheon Luncheon Lv 1 2 pts. 9,402
  4. Avatar for TJOK fan 134. TJOK fan Lv 1 2 pts. 9,399
  5. Avatar for Ernst Zundel 135. Ernst Zundel Lv 1 2 pts. 9,394
  6. Avatar for navn 136. navn Lv 1 1 pt. 9,390
  7. Avatar for martinf 137. martinf Lv 1 1 pt. 9,388
  8. Avatar for ManVsYard 138. ManVsYard Lv 1 1 pt. 9,376
  9. Avatar for severin333 139. severin333 Lv 1 1 pt. 9,369
  10. Avatar for alwen 140. alwen Lv 1 1 pt. 9,366

Comments