Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286
  1. Avatar for mirjamvandelft 181. mirjamvandelft Lv 1 1 pt. 9,133
  2. Avatar for mebruton42 182. mebruton42 Lv 1 1 pt. 9,128
  3. Avatar for jarbolol15 183. jarbolol15 Lv 1 1 pt. 9,123
  4. Avatar for tscarberry1 184. tscarberry1 Lv 1 1 pt. 9,120
  5. Avatar for Altercomp 185. Altercomp Lv 1 1 pt. 9,100
  6. Avatar for Hollinas 186. Hollinas Lv 1 1 pt. 9,092
  7. Avatar for Rafael123 187. Rafael123 Lv 1 1 pt. 9,091
  8. Avatar for Alipony 188. Alipony Lv 1 1 pt. 9,091
  9. Avatar for Chinotauku 189. Chinotauku Lv 1 1 pt. 9,086
  10. Avatar for Phosphoros042 190. Phosphoros042 Lv 1 1 pt. 9,083

Comments