Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286
  1. Avatar for gmn 11. gmn Lv 1 80 pts. 9,770
  2. Avatar for bertro 12. bertro Lv 1 78 pts. 9,756
  3. Avatar for grogar7 13. grogar7 Lv 1 76 pts. 9,748
  4. Avatar for O Seki To 14. O Seki To Lv 1 75 pts. 9,747
  5. Avatar for Deleted player 15. Deleted player 73 pts. 9,744
  6. Avatar for pauldunn 16. pauldunn Lv 1 71 pts. 9,740
  7. Avatar for johnmitch 17. johnmitch Lv 1 69 pts. 9,738
  8. Avatar for gloverd 18. gloverd Lv 1 68 pts. 9,736
  9. Avatar for Mark- 19. Mark- Lv 1 66 pts. 9,735
  10. Avatar for reefyrob 20. reefyrob Lv 1 65 pts. 9,725

Comments