Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286

  1. Avatar for doctaven 201. doctaven Lv 1 1 pt. 9,037
  2. Avatar for NotJim99 202. NotJim99 Lv 1 1 pt. 9,029
  3. Avatar for franse 203. franse Lv 1 1 pt. 9,020
  4. Avatar for Inkedhands 204. Inkedhands Lv 1 1 pt. 9,017
  5. Avatar for nathanmills 205. nathanmills Lv 1 1 pt. 9,000
  6. Avatar for xanderwise7 206. xanderwise7 Lv 1 1 pt. 8,998
  7. Avatar for buzzrapide 207. buzzrapide Lv 1 1 pt. 8,975
  8. Avatar for Scolopax 208. Scolopax Lv 1 1 pt. 8,948
  9. Avatar for gbonneau07 209. gbonneau07 Lv 1 1 pt. 8,947
  10. Avatar for bendbob 210. bendbob Lv 1 1 pt. 8,933

Comments