Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286

  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 63 pts. 9,724
  2. Avatar for Idiotboy 22. Idiotboy Lv 1 61 pts. 9,721
  3. Avatar for pmdpmd 23. pmdpmd Lv 1 60 pts. 9,719
  4. Avatar for smilingone 24. smilingone Lv 1 59 pts. 9,718
  5. Avatar for mimi 25. mimi Lv 1 57 pts. 9,716
  6. Avatar for hpaege 26. hpaege Lv 1 56 pts. 9,716
  7. Avatar for drumpeter18yrs9yrs 27. drumpeter18yrs9yrs Lv 1 54 pts. 9,715
  8. Avatar for Satina 28. Satina Lv 1 53 pts. 9,712
  9. Avatar for Bletchley Park 29. Bletchley Park Lv 1 52 pts. 9,710
  10. Avatar for TomTaylor 30. TomTaylor Lv 1 50 pts. 9,709

Comments