Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286

  1. Avatar for crpainter 41. crpainter Lv 1 38 pts. 9,684
  2. Avatar for LagMasterSam 42. LagMasterSam Lv 1 37 pts. 9,683
  3. Avatar for hansvandenhof 43. hansvandenhof Lv 1 36 pts. 9,682
  4. Avatar for cobaltteal 44. cobaltteal Lv 1 35 pts. 9,682
  5. Avatar for actiasluna 45. actiasluna Lv 1 34 pts. 9,680
  6. Avatar for Aubade01 46. Aubade01 Lv 1 33 pts. 9,679
  7. Avatar for Jim Fraser 47. Jim Fraser Lv 1 32 pts. 9,678
  8. Avatar for weitzen 48. weitzen Lv 1 31 pts. 9,675
  9. Avatar for caglar 49. caglar Lv 1 30 pts. 9,672
  10. Avatar for Merf 50. Merf Lv 1 29 pts. 9,669

Comments