Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286

  1. Avatar for diamonddays 51. diamonddays Lv 1 29 pts. 9,666
  2. Avatar for deLaCeiba 52. deLaCeiba Lv 1 28 pts. 9,665
  3. Avatar for Blipperman 53. Blipperman Lv 1 27 pts. 9,664
  4. Avatar for nemo7731 54. nemo7731 Lv 1 26 pts. 9,663
  5. Avatar for Bushman 55. Bushman Lv 1 25 pts. 9,663
  6. Avatar for fishercat 56. fishercat Lv 1 25 pts. 9,661
  7. Avatar for jamiexq 57. jamiexq Lv 1 24 pts. 9,659
  8. Avatar for Superphosphate 58. Superphosphate Lv 1 23 pts. 9,658
  9. Avatar for Museka 59. Museka Lv 1 23 pts. 9,656
  10. Avatar for guineapig 60. guineapig Lv 1 22 pts. 9,650

Comments