Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,037
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 8,286
  1. Avatar for Mike Lewis 81. Mike Lewis Lv 1 11 pts. 9,584
  2. Avatar for eromana 82. eromana Lv 1 11 pts. 9,582
  3. Avatar for ViJay7019 83. ViJay7019 Lv 1 11 pts. 9,579
  4. Avatar for tarimo 84. tarimo Lv 1 10 pts. 9,577
  5. Avatar for Deleted player 85. Deleted player pts. 9,577
  6. Avatar for cbwest 86. cbwest Lv 1 10 pts. 9,574
  7. Avatar for D001x_ErlandStevens 87. D001x_ErlandStevens Lv 1 9 pts. 9,570
  8. Avatar for FreeFolder 88. FreeFolder Lv 1 9 pts. 9,565
  9. Avatar for smholst 89. smholst Lv 1 9 pts. 9,565
  10. Avatar for johngran 90. johngran Lv 1 8 pts. 9,564

Comments