Placeholder image of a protein
Icon representing a puzzle

1216: Revisiting Puzzle 146: Rosetta Decoy 9

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is a phosphatase that participates in several metabolic pathways; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AEGDTLISVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTDQGTVQGQLQGPASKVRHMQEWLETKGSPKSHIDRASFHNEKVIVKLDYTDFQIVK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,815
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 79 pts. 9,810
  3. Avatar for Beta Folders 3. Beta Folders 61 pts. 9,808
  4. Avatar for Go Science 4. Go Science 47 pts. 9,804
  5. Avatar for Contenders 5. Contenders 35 pts. 9,773
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,772
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,747
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,724
  9. Avatar for Deleted group 9. Deleted group pts. 9,715
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 7 pts. 9,665
  1. Avatar for DodoBird 101. DodoBird Lv 1 6 pts. 9,531
  2. Avatar for froggs554 102. froggs554 Lv 1 5 pts. 9,526
  3. Avatar for JUMELLE54 103. JUMELLE54 Lv 1 5 pts. 9,524
  4. Avatar for ecali 104. ecali Lv 1 5 pts. 9,520
  5. Avatar for arginia 105. arginia Lv 1 5 pts. 9,517
  6. Avatar for mrmookie 106. mrmookie Lv 1 5 pts. 9,508
  7. Avatar for MaartenDesnouck 107. MaartenDesnouck Lv 1 4 pts. 9,507
  8. Avatar for jebbiek 108. jebbiek Lv 1 4 pts. 9,497
  9. Avatar for Mr_Jolty 109. Mr_Jolty Lv 1 4 pts. 9,493
  10. Avatar for pfirth 110. pfirth Lv 1 4 pts. 9,489

Comments