Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 8,396
  2. Avatar for DCC Folders 12. DCC Folders 4 pts. 8,320
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 2 pts. 8,245
  4. Avatar for CHNO Junkies 14. CHNO Junkies 2 pts. 7,910
  5. Avatar for WSU Bioc Spring 2016 15. WSU Bioc Spring 2016 1 pt. 7,818
  6. Avatar for Natural Abilities 16. Natural Abilities 1 pt. 7,779
  7. Avatar for It's over 9000! 18. It's over 9000! 1 pt. 7,317
  8. Avatar for Czech National Team 19. Czech National Team 1 pt. 6,645
  9. Avatar for Team South Africa 20. Team South Africa 1 pt. 5,950

  1. Avatar for Mr_Jolty 121. Mr_Jolty Lv 1 4 pts. 7,779
  2. Avatar for Ernst Zundel 122. Ernst Zundel Lv 1 4 pts. 7,778
  3. Avatar for Pro Lapser 123. Pro Lapser Lv 1 4 pts. 7,777
  4. Avatar for Mydogisa Toelicker 124. Mydogisa Toelicker Lv 1 4 pts. 7,776
  5. Avatar for Colostomy EXPLOSION. 125. Colostomy EXPLOSION. Lv 1 4 pts. 7,776
  6. Avatar for NameChangeNeeded01 126. NameChangeNeeded01 Lv 1 4 pts. 7,776
  7. Avatar for PrettyPony2001 127. PrettyPony2001 Lv 1 4 pts. 7,775
  8. Avatar for TJOK fan 128. TJOK fan Lv 1 3 pts. 7,772
  9. Avatar for nathanmills 129. nathanmills Lv 1 3 pts. 7,766
  10. Avatar for Soggy Doglog 130. Soggy Doglog Lv 1 3 pts. 7,766

Comments