Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,194
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 80 pts. 9,106
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,055
  4. Avatar for Go Science 4. Go Science 49 pts. 9,021
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 9,020
  6. Avatar for Contenders 6. Contenders 28 pts. 9,006
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 8,954
  8. Avatar for Gargleblasters 8. Gargleblasters 15 pts. 8,890
  9. Avatar for Deleted group 9. Deleted group pts. 8,587
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 8,519

  1. Avatar for Mr_Jolty 121. Mr_Jolty Lv 1 4 pts. 7,779
  2. Avatar for Ernst Zundel 122. Ernst Zundel Lv 1 4 pts. 7,778
  3. Avatar for Pro Lapser 123. Pro Lapser Lv 1 4 pts. 7,777
  4. Avatar for Mydogisa Toelicker 124. Mydogisa Toelicker Lv 1 4 pts. 7,776
  5. Avatar for Colostomy EXPLOSION. 125. Colostomy EXPLOSION. Lv 1 4 pts. 7,776
  6. Avatar for NameChangeNeeded01 126. NameChangeNeeded01 Lv 1 4 pts. 7,776
  7. Avatar for PrettyPony2001 127. PrettyPony2001 Lv 1 4 pts. 7,775
  8. Avatar for TJOK fan 128. TJOK fan Lv 1 3 pts. 7,772
  9. Avatar for nathanmills 129. nathanmills Lv 1 3 pts. 7,766
  10. Avatar for Soggy Doglog 130. Soggy Doglog Lv 1 3 pts. 7,766

Comments