Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0

  1. Avatar for arginia 101. arginia Lv 1 8 pts. 8,006
  2. Avatar for JMStiffler 102. JMStiffler Lv 1 8 pts. 8,004
  3. Avatar for Flagg65a 103. Flagg65a Lv 1 8 pts. 7,982
  4. Avatar for boondog 104. boondog Lv 1 8 pts. 7,979
  5. Avatar for NinjaGreg 105. NinjaGreg Lv 1 7 pts. 7,972
  6. Avatar for johngran 106. johngran Lv 1 7 pts. 7,965
  7. Avatar for t012 107. t012 Lv 1 7 pts. 7,954
  8. Avatar for smholst 108. smholst Lv 1 7 pts. 7,913
  9. Avatar for pmlkjn 109. pmlkjn Lv 1 7 pts. 7,910
  10. Avatar for 01010011111 110. 01010011111 Lv 1 6 pts. 7,903

Comments