Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0
  1. Avatar for Hollinas 111. Hollinas Lv 1 6 pts. 7,866
  2. Avatar for navn 112. navn Lv 1 6 pts. 7,853
  3. Avatar for cbwest 113. cbwest Lv 1 6 pts. 7,843
  4. Avatar for mshkembi 114. mshkembi Lv 1 6 pts. 7,818
  5. Avatar for Auntecedent 115. Auntecedent Lv 1 5 pts. 7,816
  6. Avatar for Festering Wounds 116. Festering Wounds Lv 1 5 pts. 7,789
  7. Avatar for mitarcher 117. mitarcher Lv 1 5 pts. 7,785
  8. Avatar for Truncheon Luncheon 118. Truncheon Luncheon Lv 1 5 pts. 7,782
  9. Avatar for JUMELLE54 119. JUMELLE54 Lv 1 5 pts. 7,781
  10. Avatar for Graham MF 120. Graham MF Lv 1 5 pts. 7,781

Comments