Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0
  1. Avatar for Wheeler22 151. Wheeler22 Lv 1 2 pts. 7,385
  2. Avatar for rinze 152. rinze Lv 1 2 pts. 7,360
  3. Avatar for Deleted player 153. Deleted player pts. 7,320
  4. Avatar for BCAA 154. BCAA Lv 1 1 pt. 7,317
  5. Avatar for NotJim99 155. NotJim99 Lv 1 1 pt. 7,288
  6. Avatar for Tac1 156. Tac1 Lv 1 1 pt. 7,277
  7. Avatar for DScott 157. DScott Lv 1 1 pt. 7,246
  8. Avatar for kyuheonre1024 158. kyuheonre1024 Lv 1 1 pt. 7,216
  9. Avatar for Deleted player 159. Deleted player 1 pt. 7,177
  10. Avatar for momadoc 160. momadoc Lv 1 1 pt. 7,141

Comments