Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0

  1. Avatar for YorPrints 201. YorPrints Lv 1 1 pt. 5,161
  2. Avatar for lamoille 202. lamoille Lv 1 1 pt. 5,080
  3. Avatar for brooney6366 203. brooney6366 Lv 1 1 pt. 5,054
  4. Avatar for FreeFolder 204. FreeFolder Lv 1 1 pt. 5,030
  5. Avatar for tigerreye 205. tigerreye Lv 1 1 pt. 5,028
  6. Avatar for 341441 206. 341441 Lv 1 1 pt. 4,913
  7. Avatar for Inkedhands 207. Inkedhands Lv 1 1 pt. 4,887
  8. Avatar for bob123456789bob 208. bob123456789bob Lv 1 1 pt. 4,810
  9. Avatar for penteplayer 209. penteplayer Lv 1 1 pt. 4,719
  10. Avatar for zkm 210. zkm Lv 1 1 pt. 4,675

Comments