Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0
  1. Avatar for Cbob 211. Cbob Lv 1 1 pt. 4,603
  2. Avatar for Codease 212. Codease Lv 1 1 pt. 4,489
  3. Avatar for Stephanix452 213. Stephanix452 Lv 1 1 pt. 4,485
  4. Avatar for fieldman 214. fieldman Lv 1 1 pt. 4,474
  5. Avatar for YumatovShow 215. YumatovShow Lv 1 1 pt. 4,473
  6. Avatar for briemoney 216. briemoney Lv 1 1 pt. 4,387
  7. Avatar for Psych0Active 217. Psych0Active Lv 1 1 pt. 4,382
  8. Avatar for gempetros 218. gempetros Lv 1 1 pt. 4,382
  9. Avatar for zack1998 219. zack1998 Lv 1 1 pt. 4,382
  10. Avatar for mirjamvandelft 220. mirjamvandelft Lv 1 1 pt. 4,301

Comments