Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0

  1. Avatar for gbonneau07 231. gbonneau07 Lv 1 1 pt. 3,777
  2. Avatar for froggs554 232. froggs554 Lv 1 1 pt. 3,759
  3. Avatar for Softeis 233. Softeis Lv 1 1 pt. 3,738
  4. Avatar for bluewinters 234. bluewinters Lv 1 1 pt. 1,918
  5. Avatar for placid.lion 235. placid.lion Lv 1 1 pt. 443
  6. Avatar for tsarsaltin 237. tsarsaltin Lv 1 1 pt. 0
  7. Avatar for Pornadomario 238. Pornadomario Lv 1 1 pt. 0
  8. Avatar for aspadistra 239. aspadistra Lv 1 1 pt. 0

Comments