Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups


  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0

  1. Avatar for sheerbliss 241. sheerbliss Lv 1 1 pt. 0
  2. Avatar for Pathogenesis 242. Pathogenesis Lv 1 1 pt. 0
  3. Avatar for Paulo Roque 243. Paulo Roque Lv 1 1 pt. 0
  4. Avatar for Satina 245. Satina Lv 1 1 pt. 0
  5. Avatar for valhal 246. valhal Lv 1 1 pt. 0
  6. Avatar for gdnskye 247. gdnskye Lv 1 1 pt. 0
  7. Avatar for ivalnic 248. ivalnic Lv 1 1 pt. 0
  8. Avatar for Savagor 249. Savagor Lv 1 1 pt. 0
  9. Avatar for foufou 250. foufou Lv 1 1 pt. 0

Comments