Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0
  1. Avatar for actiasluna 21. actiasluna Lv 1 67 pts. 8,866
  2. Avatar for Mark- 22. Mark- Lv 1 65 pts. 8,862
  3. Avatar for andrewxc 23. andrewxc Lv 1 64 pts. 8,843
  4. Avatar for Skippysk8s 24. Skippysk8s Lv 1 62 pts. 8,829
  5. Avatar for Bletchley Park 25. Bletchley Park Lv 1 61 pts. 8,812
  6. Avatar for bertro 26. bertro Lv 1 60 pts. 8,786
  7. Avatar for frood66 27. frood66 Lv 1 58 pts. 8,781
  8. Avatar for gloverd 28. gloverd Lv 1 57 pts. 8,761
  9. Avatar for Blipperman 29. Blipperman Lv 1 56 pts. 8,758
  10. Avatar for Glen B 30. Glen B Lv 1 55 pts. 8,754

Comments