Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0
  1. Avatar for alcor29 61. alcor29 Lv 1 26 pts. 8,469
  2. Avatar for pmthomson90 62. pmthomson90 Lv 1 25 pts. 8,462
  3. Avatar for TomTaylor 63. TomTaylor Lv 1 25 pts. 8,458
  4. Avatar for Qfast 64. Qfast Lv 1 24 pts. 8,437
  5. Avatar for TastyMunchies 65. TastyMunchies Lv 1 23 pts. 8,421
  6. Avatar for kitek314_pl 66. kitek314_pl Lv 1 23 pts. 8,396
  7. Avatar for Giant Berk 67. Giant Berk Lv 1 22 pts. 8,359
  8. Avatar for ratqueen03 68. ratqueen03 Lv 1 22 pts. 8,357
  9. Avatar for weitzen 69. weitzen Lv 1 21 pts. 8,346
  10. Avatar for WBarme1234 70. WBarme1234 Lv 1 21 pts. 8,340

Comments