Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0
  1. Avatar for DodoBird 71. DodoBird Lv 1 20 pts. 8,332
  2. Avatar for jstoddard 72. jstoddard Lv 1 19 pts. 8,320
  3. Avatar for tarimo 73. tarimo Lv 1 19 pts. 8,312
  4. Avatar for harvardman 74. harvardman Lv 1 18 pts. 8,285
  5. Avatar for stomjoh 75. stomjoh Lv 1 18 pts. 8,282
  6. Avatar for manu8170 76. manu8170 Lv 1 17 pts. 8,271
  7. Avatar for D001x_ErlandStevens 77. D001x_ErlandStevens Lv 1 17 pts. 8,245
  8. Avatar for Bushman 78. Bushman Lv 1 17 pts. 8,244
  9. Avatar for Deleted player 79. Deleted player pts. 8,219
  10. Avatar for YeshuaLives 80. YeshuaLives Lv 1 16 pts. 8,218

Comments