Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 5,827
  2. Avatar for CH 150 class 22. CH 150 class 1 pt. 5,613
  3. Avatar for DSN @ Home 23. DSN @ Home 1 pt. 0
  1. Avatar for TK.Writer 81. TK.Writer Lv 1 15 pts. 8,208
  2. Avatar for Crossed Sticks 82. Crossed Sticks Lv 1 15 pts. 8,206
  3. Avatar for SKSbell 83. SKSbell Lv 1 14 pts. 8,203
  4. Avatar for YGK 84. YGK Lv 1 14 pts. 8,198
  5. Avatar for LagMasterSam 85. LagMasterSam Lv 1 14 pts. 8,183
  6. Avatar for guineapig 86. guineapig Lv 1 13 pts. 8,164
  7. Avatar for ecali 87. ecali Lv 1 13 pts. 8,157
  8. Avatar for alwen 88. alwen Lv 1 12 pts. 8,156
  9. Avatar for Superphosphate 89. Superphosphate Lv 1 12 pts. 8,148
  10. Avatar for diamonddays 90. diamonddays Lv 1 12 pts. 8,141

Comments