Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,194
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 80 pts. 9,106
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,055
  4. Avatar for Go Science 4. Go Science 49 pts. 9,021
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 9,020
  6. Avatar for Contenders 6. Contenders 28 pts. 9,006
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 8,954
  8. Avatar for Gargleblasters 8. Gargleblasters 15 pts. 8,890
  9. Avatar for Deleted group 9. Deleted group pts. 8,587
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 8,519
  1. Avatar for spvincent 11. spvincent Lv 1 82 pts. 8,995
  2. Avatar for Bruno Kestemont 12. Bruno Kestemont Lv 1 80 pts. 8,995
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 79 pts. 8,990
  4. Avatar for pauldunn 14. pauldunn Lv 1 77 pts. 8,968
  5. Avatar for jermainiac 15. jermainiac Lv 1 76 pts. 8,968
  6. Avatar for dcrwheeler 16. dcrwheeler Lv 1 74 pts. 8,958
  7. Avatar for Timo van der Laan 17. Timo van der Laan Lv 1 72 pts. 8,954
  8. Avatar for isaksson 18. isaksson Lv 1 71 pts. 8,943
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 69 pts. 8,931
  10. Avatar for crpainter 20. crpainter Lv 1 68 pts. 8,882

Comments