Placeholder image of a protein
Icon representing a puzzle

1218: Unsolved De-novo Freestyle 77

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SDNGEIVKITVDGNVYGTYSLTKNQEIEIKTDKGKNIVWIHDNCVEMKEADCPDKYCVKQGKITKTRQNIVCLPHKVVVEIAVSDNTKGNEADVIAK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,194
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 80 pts. 9,106
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,055
  4. Avatar for Go Science 4. Go Science 49 pts. 9,021
  5. Avatar for HMT heritage 5. HMT heritage 37 pts. 9,020
  6. Avatar for Contenders 6. Contenders 28 pts. 9,006
  7. Avatar for Void Crushers 7. Void Crushers 21 pts. 8,954
  8. Avatar for Gargleblasters 8. Gargleblasters 15 pts. 8,890
  9. Avatar for Deleted group 9. Deleted group pts. 8,587
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 8,519
  1. Avatar for johnmitch 31. johnmitch Lv 1 53 pts. 8,754
  2. Avatar for nicobul 32. nicobul Lv 1 52 pts. 8,752
  3. Avatar for hansvandenhof 33. hansvandenhof Lv 1 51 pts. 8,717
  4. Avatar for caglar 34. caglar Lv 1 50 pts. 8,716
  5. Avatar for LociOiling 35. LociOiling Lv 1 49 pts. 8,711
  6. Avatar for justjustin 36. justjustin Lv 1 48 pts. 8,707
  7. Avatar for Marvelz 37. Marvelz Lv 1 47 pts. 8,705
  8. Avatar for mimi 38. mimi Lv 1 46 pts. 8,684
  9. Avatar for bendbob 39. bendbob Lv 1 45 pts. 8,684
  10. Avatar for Scopper 40. Scopper Lv 1 43 pts. 8,679

Comments