Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 6 pts. 9,843
  2. Avatar for It's over 9000! 12. It's over 9000! 4 pts. 9,703
  3. Avatar for D001x Med Chem MOOC 13. D001x Med Chem MOOC 3 pts. 9,699
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 9,663
  5. Avatar for foldeRNA 15. foldeRNA 1 pt. 9,559
  6. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 9,465
  7. Avatar for Czech National Team 18. Czech National Team 1 pt. 9,388
  8. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 9,371
  9. Avatar for Deleted group 20. Deleted group pts. 9,329

  1. Avatar for mirp 21. mirp Lv 1 63 pts. 10,031
  2. Avatar for pmdpmd 22. pmdpmd Lv 1 62 pts. 10,029
  3. Avatar for g_b 23. g_b Lv 1 60 pts. 10,026
  4. Avatar for DodoBird 24. DodoBird Lv 1 59 pts. 10,019
  5. Avatar for bendbob 25. bendbob Lv 1 57 pts. 10,019
  6. Avatar for O Seki To 26. O Seki To Lv 1 56 pts. 10,010
  7. Avatar for Idiotboy 27. Idiotboy Lv 1 54 pts. 10,006
  8. Avatar for Mark- 28. Mark- Lv 1 53 pts. 10,006
  9. Avatar for andrewxc 29. andrewxc Lv 1 52 pts. 10,003
  10. Avatar for grogar7 30. grogar7 Lv 1 50 pts. 10,002

Comments