1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Summary

• Created: April 12, 2016
• Expires: April 20, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

• 1. Beta Folders 100 pts. 10,220
• 2. Anthropic Dreams 81 pts. 10,131
• 3. L'Alliance Francophone 64 pts. 10,113
• 4. Contenders 50 pts. 10,104
• 5. Go Science 39 pts. 10,102
• 6. Gargleblasters 30 pts. 10,086
• 7. Void Crushers 23 pts. 10,048
• 8. HMT heritage 17 pts. 10,010
• 9. BOINC@Poland 12 pts. 9,999
• 10. Deleted group pts. 9,843

Top soloists

• 21. mirp 63 pts. 10,031
• 22. pmdpmd 62 pts. 10,029
• 23. g_b 60 pts. 10,026
• 24. DodoBird 59 pts. 10,019
• 25. bendbob 57 pts. 10,019
• 26. O Seki To 56 pts. 10,010
• 27. Idiotboy 54 pts. 10,006
• 28. Mark- 53 pts. 10,006
• 29. andrewxc 52 pts. 10,003
• 30. grogar7 50 pts. 10,002