Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 9,285
  2. Avatar for SETI.Germany 22. SETI.Germany 1 pt. 9,228
  3. Avatar for FoldIt@Netherlands 23. FoldIt@Netherlands 1 pt. 8,338
  4. Avatar for DCC Folders 24. DCC Folders 1 pt. 8,338

  1. Avatar for Flagg65a 51. Flagg65a Lv 1 29 pts. 9,904
  2. Avatar for hpaege 52. hpaege Lv 1 28 pts. 9,901
  3. Avatar for pvc78 53. pvc78 Lv 1 27 pts. 9,894
  4. Avatar for TomTaylor 54. TomTaylor Lv 1 26 pts. 9,894
  5. Avatar for Jim Fraser 55. Jim Fraser Lv 1 26 pts. 9,885
  6. Avatar for WBarme1234 56. WBarme1234 Lv 1 25 pts. 9,874
  7. Avatar for toshiue 57. toshiue Lv 1 24 pts. 9,872
  8. Avatar for fiendish_ghoul 58. fiendish_ghoul Lv 1 24 pts. 9,871
  9. Avatar for Incongruous 59. Incongruous Lv 1 23 pts. 9,865
  10. Avatar for joremen 60. joremen Lv 1 22 pts. 9,858

Comments