Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 10,220
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 10,131
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 64 pts. 10,113
  4. Avatar for Contenders 4. Contenders 50 pts. 10,104
  5. Avatar for Go Science 5. Go Science 39 pts. 10,102
  6. Avatar for Gargleblasters 6. Gargleblasters 30 pts. 10,086
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 10,048
  8. Avatar for HMT heritage 8. HMT heritage 17 pts. 10,010
  9. Avatar for BOINC@Poland 9. BOINC@Poland 12 pts. 9,999
  10. Avatar for Deleted group 10. Deleted group pts. 9,843

  1. Avatar for Flagg65a 51. Flagg65a Lv 1 29 pts. 9,904
  2. Avatar for hpaege 52. hpaege Lv 1 28 pts. 9,901
  3. Avatar for pvc78 53. pvc78 Lv 1 27 pts. 9,894
  4. Avatar for TomTaylor 54. TomTaylor Lv 1 26 pts. 9,894
  5. Avatar for Jim Fraser 55. Jim Fraser Lv 1 26 pts. 9,885
  6. Avatar for WBarme1234 56. WBarme1234 Lv 1 25 pts. 9,874
  7. Avatar for toshiue 57. toshiue Lv 1 24 pts. 9,872
  8. Avatar for fiendish_ghoul 58. fiendish_ghoul Lv 1 24 pts. 9,871
  9. Avatar for Incongruous 59. Incongruous Lv 1 23 pts. 9,865
  10. Avatar for joremen 60. joremen Lv 1 22 pts. 9,858

Comments