Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary


Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups


  1. Avatar for Beta Folders 100 pts. 10,220
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 10,131
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 64 pts. 10,113
  4. Avatar for Contenders 4. Contenders 50 pts. 10,104
  5. Avatar for Go Science 5. Go Science 39 pts. 10,102
  6. Avatar for Gargleblasters 6. Gargleblasters 30 pts. 10,086
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 10,048
  8. Avatar for HMT heritage 8. HMT heritage 17 pts. 10,010
  9. Avatar for BOINC@Poland 9. BOINC@Poland 12 pts. 9,999
  10. Avatar for Deleted group 10. Deleted group pts. 9,843

  1. Avatar for doctaven 191. doctaven Lv 1 1 pt. 9,285
  2. Avatar for ivalnic 192. ivalnic Lv 1 1 pt. 9,278
  3. Avatar for Rraiders_34 193. Rraiders_34 Lv 1 1 pt. 9,270
  4. Avatar for RaeRae61 194. RaeRae61 Lv 1 1 pt. 9,264
  5. Avatar for briemoney 195. briemoney Lv 1 1 pt. 9,248
  6. Avatar for Ronin-Sensei 196. Ronin-Sensei Lv 1 1 pt. 9,245
  7. Avatar for Phosphoros042 197. Phosphoros042 Lv 1 1 pt. 9,244
  8. Avatar for dkakins42 198. dkakins42 Lv 1 1 pt. 9,239
  9. Avatar for RAH 199. RAH Lv 1 1 pt. 9,235
  10. Avatar for folder3 200. folder3 Lv 1 1 pt. 9,235

Comments