Placeholder image of a protein
Icon representing a puzzle

1219: Revisiting Puzzle 147: Rosetta Decoy 10

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a signaling pathway that regulates sporulation in B. subtilis; the starting structure is a model produced by Rosetta. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


NEKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,220
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 10,131
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 64 pts. 10,113
  4. Avatar for Contenders 4. Contenders 50 pts. 10,104
  5. Avatar for Go Science 5. Go Science 39 pts. 10,102
  6. Avatar for Gargleblasters 6. Gargleblasters 30 pts. 10,086
  7. Avatar for Void Crushers 7. Void Crushers 23 pts. 10,048
  8. Avatar for HMT heritage 8. HMT heritage 17 pts. 10,010
  9. Avatar for BOINC@Poland 9. BOINC@Poland 12 pts. 9,999
  10. Avatar for Deleted group 10. Deleted group pts. 9,843
  1. Avatar for khendarg 171. khendarg Lv 1 1 pt. 9,399
  2. Avatar for tabbycat10uk 172. tabbycat10uk Lv 1 1 pt. 9,388
  3. Avatar for Lumir 173. Lumir Lv 1 1 pt. 9,388
  4. Avatar for DrTree 174. DrTree Lv 1 1 pt. 9,380
  5. Avatar for yousungsung 175. yousungsung Lv 1 1 pt. 9,378
  6. Avatar for isantheautumn 176. isantheautumn Lv 1 1 pt. 9,376
  7. Avatar for aspadistra 177. aspadistra Lv 1 1 pt. 9,371
  8. Avatar for momadoc 178. momadoc Lv 1 1 pt. 9,369
  9. Avatar for vacmar 179. vacmar Lv 1 1 pt. 9,367
  10. Avatar for kodi4444 180. kodi4444 Lv 1 1 pt. 9,337

Comments