Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for It's over 9000! 11. It's over 9000! 5 pts. 9,195
  2. Avatar for Natural Abilities 12. Natural Abilities 4 pts. 9,187
  3. Avatar for BOINC@Poland 13. BOINC@Poland 2 pts. 9,149
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 2 pts. 9,117
  5. Avatar for TheBirds 16. TheBirds 1 pt. 8,974
  6. Avatar for CHNO Junkies 17. CHNO Junkies 1 pt. 8,958
  7. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 8,948
  8. Avatar for Deleted group 19. Deleted group pts. 8,793
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 8,576

  1. Avatar for Museka 41. Museka Lv 1 42 pts. 9,465
  2. Avatar for Mike Lewis 42. Mike Lewis Lv 1 41 pts. 9,463
  3. Avatar for christioanchauvin 43. christioanchauvin Lv 1 41 pts. 9,459
  4. Avatar for pauldunn 44. pauldunn Lv 1 40 pts. 9,457
  5. Avatar for alwen 45. alwen Lv 1 39 pts. 9,452
  6. Avatar for fiendish_ghoul 46. fiendish_ghoul Lv 1 38 pts. 9,439
  7. Avatar for Anfinsen_slept_here 47. Anfinsen_slept_here Lv 1 37 pts. 9,404
  8. Avatar for Bushman 48. Bushman Lv 1 36 pts. 9,402
  9. Avatar for jobo0502 49. jobo0502 Lv 1 35 pts. 9,400
  10. Avatar for drumpeter18yrs9yrs 50. drumpeter18yrs9yrs Lv 1 34 pts. 9,386

Comments