Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

  1. Avatar for SETI.Germany 21. SETI.Germany 1 pt. 8,487
  2. Avatar for freefolder 22. freefolder 1 pt. 8,459
  3. Avatar for Window Group 23. Window Group 1 pt. 7,653
  1. Avatar for pmlkjn 141. pmlkjn Lv 1 2 pts. 8,958
  2. Avatar for JohannesG 142. JohannesG Lv 1 2 pts. 8,957
  3. Avatar for martinf 143. martinf Lv 1 2 pts. 8,956
  4. Avatar for shettler 144. shettler Lv 1 2 pts. 8,956
  5. Avatar for Qfast 145. Qfast Lv 1 2 pts. 8,956
  6. Avatar for Tehnologik1 146. Tehnologik1 Lv 1 2 pts. 8,955
  7. Avatar for Jajaboman 147. Jajaboman Lv 1 2 pts. 8,948
  8. Avatar for Altejos349 148. Altejos349 Lv 1 2 pts. 8,945
  9. Avatar for DrTree 149. DrTree Lv 1 2 pts. 8,944
  10. Avatar for NinjaGreg 150. NinjaGreg Lv 1 2 pts. 8,933

Comments