1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since almost 10 years ago

Summary

• Created: April 19, 2016
• Expires: April 27, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups

• 1. Beta Folders 100 pts. 9,807
• 2. Gargleblasters 80 pts. 9,738
• 3. Anthropic Dreams 63 pts. 9,712
• 4. Go Science 49 pts. 9,702
• 5. Contenders 37 pts. 9,700
• 6. Void Crushers 28 pts. 9,620
• 7. L'Alliance Francophone 21 pts. 9,611
• 8. HMT heritage 15 pts. 9,480
• 9. Italiani Al Lavoro 11 pts. 9,402
• 10. Deleted group pts. 9,386

Top soloists

• 111. D001x_ErlandStevens 6 pts. 9,117
• 112. johngran 6 pts. 9,098
• 113. stomjoh 6 pts. 9,098
• 114. Mydogisa Toelicker 6 pts. 9,097
• 115. TK.Writer 5 pts. 9,092
• 116. Colostomy EXPLOSION. 5 pts. 9,091
• 117. WarpSpeed 5 pts. 9,087
• 118. fishercat 5 pts. 9,078
• 119. SouperGenious 5 pts. 9,064
• 120. JUMELLE54 5 pts. 9,049