Placeholder image of a protein
Icon representing a puzzle

1222: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 19, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Beta Folders 100 pts. 9,807
  2. Avatar for Gargleblasters 2. Gargleblasters 80 pts. 9,738
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 9,712
  4. Avatar for Go Science 4. Go Science 49 pts. 9,702
  5. Avatar for Contenders 5. Contenders 37 pts. 9,700
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 9,620
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,611
  8. Avatar for HMT heritage 8. HMT heritage 15 pts. 9,480
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,402
  10. Avatar for Deleted group 10. Deleted group pts. 9,386

  1. Avatar for harvardman 131. harvardman Lv 1 3 pts. 9,001
  2. Avatar for hada 132. hada Lv 1 3 pts. 9,000
  3. Avatar for Atrax92 133. Atrax92 Lv 1 3 pts. 8,995
  4. Avatar for pandapharmd 134. pandapharmd Lv 1 3 pts. 8,985
  5. Avatar for eromana 135. eromana Lv 1 3 pts. 8,981
  6. Avatar for nemo7731 136. nemo7731 Lv 1 3 pts. 8,977
  7. Avatar for froggs554 137. froggs554 Lv 1 3 pts. 8,977
  8. Avatar for AndriiMiller 138. AndriiMiller Lv 1 2 pts. 8,974
  9. Avatar for penteplayer 139. penteplayer Lv 1 2 pts. 8,969
  10. Avatar for ItzExor 140. ItzExor Lv 1 2 pts. 8,965

Comments